PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00206.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 767aa    MW: 86985.6 Da    PI: 5.1086
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00206.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-16449493146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r  WT+eEd++l  av ++G ++W ++a++m  gRt+ qc +rw k
  Rsa1.0_00206.1_g00011.1 449 RREWTPEEDDQLRAAVSLFGEKDWQSVANEMD-GRTGTQCSNRWKK 493
                              678*****************************.***********98 PP

2Myb_DNA-binding40.56.2e-13511553346
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +W+ eEd++l  a + +G ++ ++Ia+ ++ gRt  qc+ rw +
  Rsa1.0_00206.1_g00011.1 511 KWSSEEDKRLRVALTFFGAKNYNKIAQFVP-GRTQSQCRARWKD 553
                              8*****************************.***********75 PP

3Myb_DNA-binding27.95.4e-09562605246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g+W++eE  +  +av+++G  +W ++a+++   Rt kqc  rw +
  Rsa1.0_00206.1_g00011.1 562 GSWSEEEITKYNEAVEEHGVSNWPKVASHVY-SRTSKQCSRRWET 605
                              78****************************9.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071717301392IPR001005SANT/Myb domain
PROSITE profilePS500904.565302390IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.5E-5305320IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-5366402IPR009057Homeodomain-like
SuperFamilySSF466894.27E-8389445IPR009057Homeodomain-like
PROSITE profilePS500907.387391443IPR017877Myb-like domain
SMARTSM007170.031395445IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10403459IPR009057Homeodomain-like
SuperFamilySSF466891.53E-19428495IPR009057Homeodomain-like
PROSITE profilePS5129422.809444499IPR017930Myb domain
SMARTSM007171.2E-14448497IPR001005SANT/Myb domain
PfamPF002491.4E-14449493IPR001005SANT/Myb domain
CDDcd001671.59E-12451495No hitNo description
Gene3DG3DSA:1.10.10.601.2E-16460496IPR009057Homeodomain-like
PROSITE profilePS5129417.399504559IPR017930Myb domain
SMARTSM007171.2E-10508557IPR001005SANT/Myb domain
CDDcd001673.09E-9511552No hitNo description
PfamPF002492.1E-11511553IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-17511562IPR009057Homeodomain-like
SuperFamilySSF466891.48E-18535608IPR009057Homeodomain-like
PROSITE profilePS5009010.046556607IPR017877Myb-like domain
SMARTSM007177.7E-9560609IPR001005SANT/Myb domain
PfamPF002498.2E-9562606IPR001005SANT/Myb domain
CDDcd001674.48E-9563606No hitNo description
Gene3DG3DSA:1.10.10.603.0E-12563611IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MMDRVSMYES DVDDDDDDDD ICEDLEELRR ACIVTDSNSG GGGMHSDSEN DEDDFEMLRS  60
IKTQLASSAT DHPMGLLSSS SSLTSEDSES DDDDDFEMLR SLNNQLALPM DDEDNDETLV  120
AICKRFSGVE GLTFMNESSP KQQVHATCNE PPSSEILSRS NTCESFSEDV QGESTSNLAA  180
ASSRSTFPES AQAFVDAIRK NRSYQKFLRT KLGEIEATIE KNEKLQKDVK IIDGFTVACK  240
RRMKQHAFSQ GKDPRFELIS TRKPRTEGNG KETSALTLGP LENPCVASYR MVLEEYPVSV  300
CRTNWSVKEN EDLAKGLKQQ LQETLIREAT ERSSDLEGCS DDIDTILESV SNLEITPEMI  360
RQFLPKVNWD QLDIKNRSAA ECEARWMSSE DPLINHGPWT AAEDDCIRLI TQNKSCTDWL  420
DVAVSLGTNR TPFQCLARYQ RSLNTDILRR EWTPEEDDQL RAAVSLFGEK DWQSVANEMD  480
GRTGTQCSNR WKKSLVPSRK RVGKSNSKEA KWSSEEDKRL RVALTFFGAK NYNKIAQFVP  540
GRTQSQCRAR WKDSLDPRLN FGSWSEEEIT KYNEAVEEHG VSNWPKVASH VYSRTSKQCS  600
RRWETLNPHL KYLKREAVRL RREATIGNFV DRESERPHLV ASDFLALAER SFEPEPVLKK  660
KRKTRQKKAD AQCESEAVCG ETERQPKRRR KGLERCSGDV CRRENENEDG GKEKKQRRKH  720
KAVAGTSSED NSTVTTDCSQ VKVGIEKLKA RRKVSAVVPI ENQDAPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-213586116155MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-213586116155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657963.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106362640
TrEMBLA0A078EE580.0A0A078EE58_BRANA; BnaC01g12000D protein
STRINGBra013415.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1